PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 468aa    MW: 52960.4 Da    PI: 6.5236
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018098genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS267.64.1e-82724422374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalklfsevsPilkfshl 96 
                   + Ll++Ae ++ +d e+a +lL     l+s +g+ ++R+++y+t AL++r+++ s+ ++++  +  e+ + +  ++    ++   +   P++++++l
  Lus10018098  72 LHHLLSAAEEMDRQDYEQAISLLDVCDSLSSRTGNLTERVVHYITHALRERVYNeSGVKISSLGEEIEKLNVEeaMTAPSPIVASIYAKIPFYQIGQL 169
                  689**************************************************966666666554333332221333334444559999********* PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  +  qaI+e+ve+++rvHiiD+ i +G+QW aL+qaLasR+ ++   l+iT+++s   gs++ ++etgerL kfA+++++p+ f+++v++++ +++ ++
  Lus10018098 170 AGVQAIVESVEKSKRVHIIDLKIRNGMQWTALMQALASRRkRDLEILKITALVS--CGSADLIRETGERLVKFAKSINIPLAFRTVVVTNMVQIDKKR 265
                  *************************************98857788*********..67**************************************** PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  L+++p++++a+ + ++l++l  ++ +     d+++ +++ ++P v+vv+e ea+ +s +F +rf+e l +y+a fd++++ + +++ +++ +E ++l+
  Lus10018098 266 LDLDPKDVVAIFSEYALQHLIGKPNQ----LDALMTVIRYIRPMVMVVIETEANFSSLDFSHRFVEELFHYAAYFDCVDTCFDNDEANKMILESMFLS 359
                  ********************955554....566***************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++  ++ +e++e   r  t   Wr+ ++++ + ++ ls +++++++ ll +++ ++  +v+ +  sl+lgWk+ p+ s+SaW+
  Lus10018098 360 EQLNGILVKEEKE-MTRSVTIDVWRKFFSQFWMLEAGLSPTTMETVNQLLGRFSsGEYCTVNMDGRSLLLGWKGTPMCSLSAWK 442
                  ************9.99**************************************666678999999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.76345421IPR005202Transcription factor GRAS
PfamPF035141.4E-7972442IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MFSPSSVELL RSCVKETMIR KAREPTSQKM SLPDIIRTAS VKFINNPSSP SESDLIPSNQ  60
EEEAITKQIG LLHHLLSAAE EMDRQDYEQA ISLLDVCDSL SSRTGNLTER VVHYITHALR  120
ERVYNESGVK ISSLGEEIEK LNVEEAMTAP SPIVASIYAK IPFYQIGQLA GVQAIVESVE  180
KSKRVHIIDL KIRNGMQWTA LMQALASRRK RDLEILKITA LVSCGSADLI RETGERLVKF  240
AKSINIPLAF RTVVVTNMVQ IDKKRLDLDP KDVVAIFSEY ALQHLIGKPN QLDALMTVIR  300
YIRPMVMVVI ETEANFSSLD FSHRFVEELF HYAAYFDCVD TCFDNDEANK MILESMFLSE  360
QLNGILVKEE KEMTRSVTID VWRKFFSQFW MLEAGLSPTT METVNQLLGR FSSGEYCTVN  420
MDGRSLLLGW KGTPMCSLSA WKFLLAKPLK QTYKKKRIMD ILDFSIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2410144233375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.13e-46GRAS family protein